Putative oxidoreductase glyr1

Author: mwhr

August undefined, 2024

WebApr 9, 2024 · Quantitative real-time PCR was used to monitor the expression of 15 Verticillium dahliae’s genes, putatively involved in pathogenicity, highly (HAV) and weakly aggressive (WAV) V. dahliae isolates after either (i) elicitation with potato leaf, stem, or root extracts, or (ii) inoculation of potato detached petioles. These genes, i.e., coding for Ras … WebPutative oxidoreductase GLYR1 ELISA Kit, 3-hydroxyisobutyrate dehydrogenase-like protein ELISA Kit, Cytokine-like nuclear factor N-PAC ELISA Kit, Glyoxylate reductase 1 homolog ELISA Kit, Nuclear protein NP60 ELISA Kit, Nuclear protein of 60 kDa ELISA Kit, ...

The Royal Society of Chemistry

Webpthr43580 oxidoreductase glyr1-related 1 hit; pthr43580:sf2 oxidoreductase glyr1-related 1 hit; mobidb. search ... WebRabbit polyclonal antibody anti-Putative Oxidoreductase Glyr1 is suitable for use in Western Blot research applications. on tv和on the tv的区别

UniProt

WebMar 21, 2024 · Complete information for GLYR1 gene (Protein Coding), Glyoxylate Reductase 1 Homolog, including: function, proteins, disorders, pathways, orthologs, and … WebNX_Q49A26 - GLYR1 - Putative oxidoreductase GLYR1 - Function. Nucleosome-destabilizing factor that is recruited to genes during transcriptional activation (PubMed:29759984). … WebNX_Q49A26 - GLYR1 - Putative oxidoreductase GLYR1 - Gh. Nucleosome-destabilizing factor that is recruited to genes during transcriptional activation (PubMed:29759984). Facilitates Pol II transcription through nucleosomes (PubMed:29759984). Binds DNA (in vitro) (PubMed:29759984). Recognizes and binds trimethylated 'Lys-36' of histone H3 … ontw1020

Glyr1 glyoxylate reductase 1 homolog (Arabidopsis) [ (house …

WebPutative oxidoreductase GLYR1. Gene. GLYR1. Source organism. Homo sapiens (Human) go to search. UniProt. Q49A26 go to UniProt. Experimental structures. 8 structures in PDB for Q49A26 go to PDBe-KB. Biological function. WebJun 25, 2024 · Eighty-three missense mutations, 1 lost stop codon in putative oxidoreductase (glyr1) and 1 premature stop codon in tripartite motif-containing protein 16 (trim16) were detected. on tv worksheetWebQ49A26 - GLYR1 - Putative oxidoreductase GLYR1 - Localization. Nucleosome-destabilizing factor that is recruited to genes during transcriptional activation (PubMed:29759984). … iot display devices

"WebDescription: Homo sapiens glyoxylate reductase 1 homolog (GLYR1), transcript variant 11, non-coding RNA. (from RefSeq NR_136700) Gencode Transcript: ENST00000321919.14 Gencode Gene: ENSG00000140632.17 Transcript (Including UTRs) " - Putative oxidoreductase glyr1

Putative oxidoreductase glyr1

WebQ922P9 Glyr1 Putative oxidoreductase GLYR1 1,27 0,006 P49813 Tmod3 Tropomodulin-3 1,26 0,007 P70349 Hint1 Histidine triad nucleotide-binding protein 1 1,25 0,006 Q9Z2C4 Mtmr1 Myotubularin-related protein 1 1,24 0,008 Q8BHL5 Elmo2 Engulfment and cell motility protein 2 1,24 0,002 Q6ZPE2 Sbf1 Myotubularin ... Webaa seq: 276 aa aa seq db search mgsgivknlinsghsvivwnrtqekcadfvkagaeqgltpsdvvlaaditfscvadpqaa khmvfgncgvlmeissdkgyvemtgidaetsqdiaeaingkggryleaqvqgsktqaqeg ...

Did you know?

WebGLYR1 Proteins. Recombinant Human Putative oxidoreductase GLYR1(GLYR1) ( Yeast-CSB-YP670983HU E.coli-CSB-EP670983HU Baculovirus-CSB-BP670983HU Mammalian cell-CSB-MP670983HU In Vivo Biotinylation in E.coli-CSB-EP670983HU-B ) WebMar 21, 2024 · GLYR1 glyoxylate reductase 1 homolog [ (human)] Gene ID: 84656, updated on 21-Mar-2024. Summary. Enables DNA binding ... 60 kDa, nuclear protein 60kDa, nuclear …

WebUniProtKB. x; UniProtKB. Protein knowledgebase. UniParc. Sequence archive. Help. Help pages, FAQs, UniProtKB manual, documents, news archive and Biocuration projects. WebSynonyms: -D-Glucose:oxygen 1-oxidoreductase, GOx Molecular mass:1 160 kDa (gel filtration) Isoelectric Point (pI):2 4.2 Extinction coefficient:3 E1% = 16.7 (280 nm) Product Description Glucose oxidase from Aspergillus niger is a dimer consisting of 2 equal subunits with a molecular mass of 80 kDa each. Each subunit contains one flavin adenine

WebSep 23, 2024 · Nuclear envelope (NE) and endoplasmic reticulum (ER) collaborate to control a multitude of nuclear and cytoplasmic actions. In this context, the transmembrane protein TMEM147 localizes to both NE and ER, and through direct and indirect interactions regulates processes as varied as production and transport of multipass membrane proteins, … WebNP60 contains 2 nuclear localization signals, an N-terminal PWWP domain and an AT-hook, and a C-terminal NAD-binding domain. Western blot, RT-PCR, and immunohistochemistry showed that NP60 localizes to the nucleus in a variety of cell lines, with robust expression in mouse macrophage RAW274.7 cells. Cotransfection experiments showed that NP60 …

WebProductivity of sugarcane (Saccharum spp.) crops varies at each cutting stage, reaching critical rates close to the fifth cut (fourth ratoon). Knowledge of proteins involved in the regrowth of sugarcane within the cutting process is important for the

WebQ49A26 - GLYR1 - Putative oxidoreductase GLYR1 - Identifiers. Nucleosome-destabilizing factor that is recruited to genes during transcriptional activation (PubMed:29759984). … iot dog daycare robotWebUniProt website fallback message If you are not seeing anything on this page, it might be for multiple reasons: You might have JavaScript disabled: make sure to ... iot domain analyst projectsWebApr 12, 2024 · cytokine-like nuclear factor N-PAC, cytokine-like nuclear factor n-pac, nuclear protein NP60, putative oxidoreductase GLYR1. GeneRIFs: Gene References Into … on tv还是on the tvhttp://www.cloud-clone.com/items/N303.html ont wall jack attWebCat no : 67340-1-Ig Synonyms. BM045, Glyoxylate reductase 1 homolog, GLYR1, HIBDL, N-PAC, Nuclear protein NP60, Nuclear protein of 60 kDa, Putative oxidoreductase GLYR1 iot download for windows 10http://www.ab-mart.com/proteinantibodies/List?page=49 ontwalletWebaa seq: 474 aa aa seq db search mikinkgkrfqqavdaveeflrrakgkdqtsshnsaddknrrnsseersrpnsgdekrkl slsegkvkknmgegkkrvssgssergsksplkraqeqsprkrgrppkdekdltipesstv ... ont wallet